General Information

  • ID:  hor005956
  • Uniprot ID:  P19425(20-29)
  • Protein name:  Trypsin-modulating oostatic factor
  • Gene name:  15a-2
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Vitelline membrane protein family
  • Source:  animal
  • Expression:  Synthesized and released from follicular epithelium 18-24 hours after a blood meal. Synthesis peaks at 36 hours and stops at 56 hours. |Expressed in the anterior region of the follicle cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0048599 oocyte development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DYPAPPPPPP
  • Length:  10(20-29)
  • Propeptide:  MNKIIAALVLFTAVIGALADYPAPPPPPPKPYHAPPPPPYHAPPHHAPAPLHPVVHTYPVKAPAAKCGANLLVGCAPSVAHVPCVPVHPHPPPPAHY
  • Signal peptide:  MNKIIAALVLFTAVIGALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  1-2DY->YD: In TMOF(A)

Activity

  • Function:  Has an oostatic activity. Inhibits trypsin biosynthesis in the midgut epithelial cells which indirectly reduces the vitellogenin concentration in the hemolymph resulting in inhibition of oocyte development.
  • Mechanism:  Can potentially be used as a larvicide. The stable three-dimensional conformation of the decapeptide means it is not degraded by gut proteolytic enzymes and can traverse the gut epithelial cells into the hemolymph of adults and larvae. Hormone fed to different species of mosquito larvae stops food digestion and causes larval mortality. The tetrapeptide (DYPA) is as effective as the decapeptide.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19425-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005956_AF2.pdbhor005956_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 120787 Formula: C51H70N10O14
Absent amino acids: CEFGHIKLMNQRSTVW Common amino acids: P
pI: 3.75 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 1
Hydrophobicity: -142 Boman Index: -705
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 10
Instability Index: 15616 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  9887508
  • Title:  Vitelline envelope genes of the yellow fever mosquito, Aedes aegypti.
  • PubMed ID:  17510324
  • Title:  Genome sequence of Aedes aegypti, a major arbovirus vector.
  • PubMed ID:  8432405
  • Title:  Structure, expression, and hormonal control of genes from the mosquito, Aedes aegypti, which encode proteins similar to the
  • PubMed ID:  2394318
  • Title:  
  • PubMed ID:  8353526
  • Title:  
  • PubMed ID:  14506222
  • Title:  
  • PubMed ID:  8512567
  • Title: